DEF6 purified MaxPab mouse polyclonal antibody (B01P)
  • DEF6 purified MaxPab mouse polyclonal antibody (B01P)

DEF6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00050619-B01P
DEF6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DEF6 protein.
Información adicional
Size 50 ug
Gene Name DEF6
Gene Alias IBP|SLAT
Gene Description differentially expressed in FDCP 6 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DEF6 (NP_071330.2, 1 a.a. ~ 631 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50619

Enviar un mensaje


DEF6 purified MaxPab mouse polyclonal antibody (B01P)

DEF6 purified MaxPab mouse polyclonal antibody (B01P)