COL5A3 monoclonal antibody (M01), clone 4B8
  • COL5A3 monoclonal antibody (M01), clone 4B8

COL5A3 monoclonal antibody (M01), clone 4B8

Ref: AB-H00050509-M01
COL5A3 monoclonal antibody (M01), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COL5A3.
Información adicional
Size 100 ug
Gene Name COL5A3
Gene Alias -
Gene Description collagen, type V, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL5A3 (NP_056534, 157 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50509
Clone Number 4B8
Iso type IgG2b Kappa

Enviar un mensaje


COL5A3 monoclonal antibody (M01), clone 4B8

COL5A3 monoclonal antibody (M01), clone 4B8