CD207 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD207 purified MaxPab rabbit polyclonal antibody (D01P)

CD207 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050489-D01P
CD207 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD207 protein.
Información adicional
Size 100 ug
Gene Name CD207
Gene Alias CLEC4K
Gene Description CD207 molecule, langerin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD207 (AAH22278.1, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50489

Enviar un mensaje


CD207 purified MaxPab rabbit polyclonal antibody (D01P)

CD207 purified MaxPab rabbit polyclonal antibody (D01P)