G0S2 purified MaxPab rabbit polyclonal antibody (D01P)
  • G0S2 purified MaxPab rabbit polyclonal antibody (D01P)

G0S2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050486-D01P
G0S2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human G0S2 protein.
Información adicional
Size 100 ug
Gene Name G0S2
Gene Alias RP1-28O10.2
Gene Description G0/G1switch 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen G0S2 (AAH09694.1, 1 a.a. ~ 103 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50486

Enviar un mensaje


G0S2 purified MaxPab rabbit polyclonal antibody (D01P)

G0S2 purified MaxPab rabbit polyclonal antibody (D01P)