EHD3 polyclonal antibody (A01)
  • EHD3 polyclonal antibody (A01)

EHD3 polyclonal antibody (A01)

Ref: AB-H00030845-A01
EHD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EHD3.
Información adicional
Size 50 uL
Gene Name EHD3
Gene Alias PAST3
Gene Description EH-domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 30845

Enviar un mensaje


EHD3 polyclonal antibody (A01)

EHD3 polyclonal antibody (A01)