ZNRD1 monoclonal antibody (M01), clone 6C12
  • ZNRD1 monoclonal antibody (M01), clone 6C12

ZNRD1 monoclonal antibody (M01), clone 6C12

Ref: AB-H00030834-M01
ZNRD1 monoclonal antibody (M01), clone 6C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNRD1.
Información adicional
Size 100 ug
Gene Name ZNRD1
Gene Alias HTEX-6|MGC13376|Rpa12|TEX6|hZR14|tctex-6
Gene Description zinc ribbon domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNRD1 (NP_055411, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30834
Clone Number 6C12
Iso type IgG1 Kappa

Enviar un mensaje


ZNRD1 monoclonal antibody (M01), clone 6C12

ZNRD1 monoclonal antibody (M01), clone 6C12