NT5C purified MaxPab mouse polyclonal antibody (B01P)
  • NT5C purified MaxPab mouse polyclonal antibody (B01P)

NT5C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00030833-B01P
NT5C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NT5C protein.
Información adicional
Size 50 ug
Gene Name NT5C
Gene Alias DNT|DNT1|P5N2|PN-I|PN-II|UMPH2|cdN|dNT-1
Gene Description 5', 3'-nucleotidase, cytosolic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NT5C (AAH08183.1, 1 a.a. ~ 117 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30833

Enviar un mensaje


NT5C purified MaxPab mouse polyclonal antibody (B01P)

NT5C purified MaxPab mouse polyclonal antibody (B01P)