KCNIP2 monoclonal antibody (M01), clone 3E7
  • KCNIP2 monoclonal antibody (M01), clone 3E7

KCNIP2 monoclonal antibody (M01), clone 3E7

Ref: AB-H00030819-M01
KCNIP2 monoclonal antibody (M01), clone 3E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KCNIP2.
Información adicional
Size 100 ug
Gene Name KCNIP2
Gene Alias DKFZp566L1246|KCHIP2|MGC17241
Gene Description Kv channel interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA,RNAi-Ab
Immunogen Prot. Seq MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNIP2 (AAH34685, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30819
Clone Number 3E7
Iso type IgG1 Kappa

Enviar un mensaje


KCNIP2 monoclonal antibody (M01), clone 3E7

KCNIP2 monoclonal antibody (M01), clone 3E7