KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)
  • KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00030819-B01P
KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KCNIP2 protein.
Información adicional
Size 50 ug
Gene Name KCNIP2
Gene Alias DKFZp566L1246|KCHIP2|MGC17241
Gene Description Kv channel interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KCNIP2 (NP_775283.1, 1 a.a. ~ 270 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30819

Enviar un mensaje


KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)