PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)
  • PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)

PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00030814-B01P
PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLA2G2E protein.
Información adicional
Size 50 ug
Gene Name PLA2G2E
Gene Alias -
Gene Description phospholipase A2, group IIE
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLA2G2E (AAI41620.1, 1 a.a. ~ 142 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30814

Enviar un mensaje


PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)

PLA2G2E purified MaxPab mouse polyclonal antibody (B01P)