SOX8 monoclonal antibody (M02), clone 8D8
  • SOX8 monoclonal antibody (M02), clone 8D8

SOX8 monoclonal antibody (M02), clone 8D8

Ref: AB-H00030812-M02
SOX8 monoclonal antibody (M02), clone 8D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX8.
Información adicional
Size 100 ug
Gene Name SOX8
Gene Alias MGC24837
Gene Description SRY (sex determining region Y)-box 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX8 (NP_055402, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30812
Clone Number 8D8
Iso type IgG2a Kappa

Enviar un mensaje


SOX8 monoclonal antibody (M02), clone 8D8

SOX8 monoclonal antibody (M02), clone 8D8