HUNK monoclonal antibody (M06), clone 1C4
  • HUNK monoclonal antibody (M06), clone 1C4

HUNK monoclonal antibody (M06), clone 1C4

Ref: AB-H00030811-M06
HUNK monoclonal antibody (M06), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HUNK.
Información adicional
Size 50 ug
Gene Name HUNK
Gene Alias -
Gene Description hormonally up-regulated Neu-associated kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HUNK (NP_055401, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30811
Clone Number 1C4
Iso type IgG2a Kappa

Enviar un mensaje


HUNK monoclonal antibody (M06), clone 1C4

HUNK monoclonal antibody (M06), clone 1C4