HUNK polyclonal antibody (A01)
  • HUNK polyclonal antibody (A01)

HUNK polyclonal antibody (A01)

Ref: AB-H00030811-A01
HUNK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HUNK.
Información adicional
Size 50 uL
Gene Name HUNK
Gene Alias -
Gene Description hormonally up-regulated Neu-associated kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HUNK (NP_055401, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 30811

Enviar un mensaje


HUNK polyclonal antibody (A01)

HUNK polyclonal antibody (A01)