RAX monoclonal antibody (M01), clone 3B3
  • RAX monoclonal antibody (M01), clone 3B3

RAX monoclonal antibody (M01), clone 3B3

Ref: AB-H00030062-M01
RAX monoclonal antibody (M01), clone 3B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAX.
Información adicional
Size 100 ug
Gene Name RAX
Gene Alias MCOP3|RX
Gene Description retina and anterior neural fold homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAX (NP_038463, 104 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30062
Clone Number 3B3
Iso type IgG2a Kappa

Enviar un mensaje


RAX monoclonal antibody (M01), clone 3B3

RAX monoclonal antibody (M01), clone 3B3