SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00030061-D01P
SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC40A1 protein.
Información adicional
Size 100 ug
Gene Name SLC40A1
Gene Alias FPN1|HFE4|IREG1|MST079|MSTP079|MTP1|SLC11A3
Gene Description solute carrier family 40 (iron-regulated transporter), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC40A1 (NP_055400.1, 1 a.a. ~ 571 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30061

Enviar un mensaje


SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC40A1 purified MaxPab rabbit polyclonal antibody (D01P)