TLX3 polyclonal antibody (A01)
  • TLX3 polyclonal antibody (A01)

TLX3 polyclonal antibody (A01)

Ref: AB-H00030012-A01
TLX3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TLX3.
Información adicional
Size 50 uL
Gene Name TLX3
Gene Alias HOX11L2|MGC29804|RNX
Gene Description T-cell leukemia homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLX3 (NP_066305, 192 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 30012

Enviar un mensaje


TLX3 polyclonal antibody (A01)

TLX3 polyclonal antibody (A01)