SH3KBP1 monoclonal antibody (M01), clone 1F11
  • SH3KBP1 monoclonal antibody (M01), clone 1F11

SH3KBP1 monoclonal antibody (M01), clone 1F11

Ref: AB-H00030011-M01
SH3KBP1 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH3KBP1.
Información adicional
Size 100 ug
Gene Name SH3KBP1
Gene Alias CIN85|GIG10|MIG18
Gene Description SH3-domain kinase binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30011
Clone Number 1F11
Iso type IgG2a Kappa

Enviar un mensaje


SH3KBP1 monoclonal antibody (M01), clone 1F11

SH3KBP1 monoclonal antibody (M01), clone 1F11