EFEMP2 monoclonal antibody (M32), clone 2A12
  • EFEMP2 monoclonal antibody (M32), clone 2A12

EFEMP2 monoclonal antibody (M32), clone 2A12

Ref: AB-H00030008-M32
EFEMP2 monoclonal antibody (M32), clone 2A12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EFEMP2.
Información adicional
Size 100 ug
Gene Name EFEMP2
Gene Alias FBLN4|MBP1|UPH1
Gene Description EGF-containing fibulin-like extracellular matrix protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EFEMP2 (AAH10456.1, 26 a.a. ~ 443 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30008
Clone Number 2A12
Iso type IgG2a Kappa

Enviar un mensaje


EFEMP2 monoclonal antibody (M32), clone 2A12

EFEMP2 monoclonal antibody (M32), clone 2A12