ERO1L monoclonal antibody (M01), clone 4G3
  • ERO1L monoclonal antibody (M01), clone 4G3

ERO1L monoclonal antibody (M01), clone 4G3

Ref: AB-H00030001-M01
ERO1L monoclonal antibody (M01), clone 4G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ERO1L.
Información adicional
Size 100 ug
Gene Name ERO1L
Gene Alias ERO1-alpha
Gene Description ERO1-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30001
Clone Number 4G3
Iso type IgG2b Kappa

Enviar un mensaje


ERO1L monoclonal antibody (M01), clone 4G3

ERO1L monoclonal antibody (M01), clone 4G3