ERO1L purified MaxPab rabbit polyclonal antibody (D01P)
  • ERO1L purified MaxPab rabbit polyclonal antibody (D01P)

ERO1L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00030001-D01P
ERO1L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ERO1L protein.
Información adicional
Size 100 ug
Gene Name ERO1L
Gene Alias ERO1-alpha
Gene Description ERO1-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERO1L (AAH08674.1, 1 a.a. ~ 468 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30001

Enviar un mensaje


ERO1L purified MaxPab rabbit polyclonal antibody (D01P)

ERO1L purified MaxPab rabbit polyclonal antibody (D01P)