ERO1L polyclonal antibody (A01)
  • ERO1L polyclonal antibody (A01)

ERO1L polyclonal antibody (A01)

Ref: AB-H00030001-A01
ERO1L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ERO1L.
Información adicional
Size 50 uL
Gene Name ERO1L
Gene Alias ERO1-alpha
Gene Description ERO1-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 30001

Enviar un mensaje


ERO1L polyclonal antibody (A01)

ERO1L polyclonal antibody (A01)