TNPO2 polyclonal antibody (A01)
  • TNPO2 polyclonal antibody (A01)

TNPO2 polyclonal antibody (A01)

Ref: AB-H00030000-A01
TNPO2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNPO2.
Información adicional
Size 50 uL
Gene Name TNPO2
Gene Alias FLJ12155|IPO3|KPNB2B|TRN2
Gene Description transportin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNPO2 (NP_038461, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 30000

Enviar un mensaje


TNPO2 polyclonal antibody (A01)

TNPO2 polyclonal antibody (A01)