GLTSCR2 monoclonal antibody (M03), clone 5A8
  • GLTSCR2 monoclonal antibody (M03), clone 5A8

GLTSCR2 monoclonal antibody (M03), clone 5A8

Ref: AB-H00029997-M03
GLTSCR2 monoclonal antibody (M03), clone 5A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLTSCR2.
Información adicional
Size 100 ug
Gene Name GLTSCR2
Gene Alias PICT-1|PICT1
Gene Description glioma tumor suppressor candidate region gene 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29997
Clone Number 5A8
Iso type IgG1 Kappa

Enviar un mensaje


GLTSCR2 monoclonal antibody (M03), clone 5A8

GLTSCR2 monoclonal antibody (M03), clone 5A8