GLTSCR2 polyclonal antibody (A01)
  • GLTSCR2 polyclonal antibody (A01)

GLTSCR2 polyclonal antibody (A01)

Ref: AB-H00029997-A01
GLTSCR2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GLTSCR2.
Información adicional
Size 50 uL
Gene Name GLTSCR2
Gene Alias PICT-1|PICT1
Gene Description glioma tumor suppressor candidate region gene 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29997

Enviar un mensaje


GLTSCR2 polyclonal antibody (A01)

GLTSCR2 polyclonal antibody (A01)