LMCD1 purified MaxPab mouse polyclonal antibody (B01P)
  • LMCD1 purified MaxPab mouse polyclonal antibody (B01P)

LMCD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029995-B01P
LMCD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LMCD1 protein.
Información adicional
Size 50 ug
Gene Name LMCD1
Gene Alias -
Gene Description LIM and cysteine-rich domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LMCD1 (NP_055398.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29995

Enviar un mensaje


LMCD1 purified MaxPab mouse polyclonal antibody (B01P)

LMCD1 purified MaxPab mouse polyclonal antibody (B01P)