LMCD1 polyclonal antibody (A01)
  • LMCD1 polyclonal antibody (A01)

LMCD1 polyclonal antibody (A01)

Ref: AB-H00029995-A01
LMCD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LMCD1.
Información adicional
Size 50 uL
Gene Name LMCD1
Gene Alias -
Gene Description LIM and cysteine-rich domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq KQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMCD1 (NP_055398, 266 a.a. ~ 364 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29995

Enviar un mensaje


LMCD1 polyclonal antibody (A01)

LMCD1 polyclonal antibody (A01)