BAZ2B purified MaxPab mouse polyclonal antibody (B01P)
  • BAZ2B purified MaxPab mouse polyclonal antibody (B01P)

BAZ2B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029994-B01P
BAZ2B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BAZ2B protein.
Información adicional
Size 50 ug
Gene Name BAZ2B
Gene Alias DKFZp434H071|DKFZp762I0516|FLJ45644|WALp4
Gene Description bromodomain adjacent to zinc finger domain, 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVLSQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEESSSLTSELRSKREQYKQAFPSQLKKQESSKSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BAZ2B (AAH12576.1, 1 a.a. ~ 643 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29994

Enviar un mensaje


BAZ2B purified MaxPab mouse polyclonal antibody (B01P)

BAZ2B purified MaxPab mouse polyclonal antibody (B01P)