NRBF2 purified MaxPab mouse polyclonal antibody (B02P)
  • NRBF2 purified MaxPab mouse polyclonal antibody (B02P)

NRBF2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00029982-B02P
NRBF2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NRBF2 protein.
Información adicional
Size 50 ug
Gene Name NRBF2
Gene Alias COPR1|COPR2|DKFZp564C1664|FLJ30395|NRBF-2
Gene Description nuclear receptor binding factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NRBF2 (NP_110386.1, 1 a.a. ~ 287 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29982

Enviar un mensaje


NRBF2 purified MaxPab mouse polyclonal antibody (B02P)

NRBF2 purified MaxPab mouse polyclonal antibody (B02P)