PSAT1 purified MaxPab mouse polyclonal antibody (B01P)
  • PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029968-B01P
PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSAT1 protein.
Información adicional
Size 50 ug
Gene Name PSAT1
Gene Alias EPIP|MGC1460|PSA|PSAT
Gene Description phosphoserine aminotransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSAT1 (NP_478059.1, 1 a.a. ~ 370 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29968

Enviar un mensaje


PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

PSAT1 purified MaxPab mouse polyclonal antibody (B01P)