FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)
  • FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)

FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029960-B01P
FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FTSJ2 protein.
Información adicional
Size 50 ug
Gene Name FTSJ2
Gene Alias DKFZp686J14194|FJH1
Gene Description FtsJ homolog 2 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FTSJ2 (NP_037525.1, 1 a.a. ~ 246 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29960

Enviar un mensaje


FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)

FTSJ2 purified MaxPab mouse polyclonal antibody (B01P)