SLC25A24 monoclonal antibody (M01), clone 2C4
  • SLC25A24 monoclonal antibody (M01), clone 2C4

SLC25A24 monoclonal antibody (M01), clone 2C4

Ref: AB-H00029957-M01
SLC25A24 monoclonal antibody (M01), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC25A24.
Información adicional
Size 100 ug
Gene Name SLC25A24
Gene Alias APC1|DKFZp586G0123|SCAMC-1
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC25A24 (NP_037518.2, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29957
Clone Number 2C4
Iso type IgG2a Kappa

Enviar un mensaje


SLC25A24 monoclonal antibody (M01), clone 2C4

SLC25A24 monoclonal antibody (M01), clone 2C4