POMT2 monoclonal antibody (M01), clone 1D9
  • POMT2 monoclonal antibody (M01), clone 1D9

POMT2 monoclonal antibody (M01), clone 1D9

Ref: AB-H00029954-M01
POMT2 monoclonal antibody (M01), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POMT2.
Información adicional
Size 100 ug
Gene Name POMT2
Gene Alias DKFZp686G10254|FLJ22309
Gene Description protein-O-mannosyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POMT2 (NP_037514, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29954
Clone Number 1D9
Iso type IgG2a Kappa

Enviar un mensaje


POMT2 monoclonal antibody (M01), clone 1D9

POMT2 monoclonal antibody (M01), clone 1D9