POMT2 polyclonal antibody (A01)
  • POMT2 polyclonal antibody (A01)

POMT2 polyclonal antibody (A01)

Ref: AB-H00029954-A01
POMT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POMT2.
Información adicional
Size 50 uL
Gene Name POMT2
Gene Alias DKFZp686G10254|FLJ22309
Gene Description protein-O-mannosyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POMT2 (NP_037514, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29954

Enviar un mensaje


POMT2 polyclonal antibody (A01)

POMT2 polyclonal antibody (A01)