DSE purified MaxPab mouse polyclonal antibody (B01P)
  • DSE purified MaxPab mouse polyclonal antibody (B01P)

DSE purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029940-B01P
DSE purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DSE protein.
Información adicional
Size 50 ug
Gene Name DSE
Gene Alias DSEPI|SART2
Gene Description dermatan sulfate epimerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRAASSHEHIAARLTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENIEARDMAKDYMERMAAQPSWLVKDAPWDEVPLAHSLVGFATAYDFLYNYLSKTQQEKFLEVIANASGYMYETSYRRGWGFQYLHNHQPTNCMALLTGSLVLMNQGYLQEAYLWTKQVLTIMEKSLVLLREVTDGSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DSE (NP_037484.1, 1 a.a. ~ 958 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29940

Enviar un mensaje


DSE purified MaxPab mouse polyclonal antibody (B01P)

DSE purified MaxPab mouse polyclonal antibody (B01P)