GMPPB monoclonal antibody (M07), clone 2B5
  • GMPPB monoclonal antibody (M07), clone 2B5

GMPPB monoclonal antibody (M07), clone 2B5

Ref: AB-H00029925-M07
GMPPB monoclonal antibody (M07), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GMPPB.
Información adicional
Size 100 ug
Gene Name GMPPB
Gene Alias KIAA1851
Gene Description GDP-mannose pyrophosphorylase B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMPPB (NP_037466, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29925
Clone Number 2B5
Iso type IgG2b Kappa

Enviar un mensaje


GMPPB monoclonal antibody (M07), clone 2B5

GMPPB monoclonal antibody (M07), clone 2B5