NME7 monoclonal antibody (M08A), clone 1A11
  • NME7 monoclonal antibody (M08A), clone 1A11

NME7 monoclonal antibody (M08A), clone 1A11

Ref: AB-H00029922-M08A
NME7 monoclonal antibody (M08A), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NME7.
Información adicional
Size 200 uL
Gene Name NME7
Gene Alias FLJ37194|nm23-H7
Gene Description non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 29922
Clone Number 1A11
Iso type IgG1 Kappa

Enviar un mensaje


NME7 monoclonal antibody (M08A), clone 1A11

NME7 monoclonal antibody (M08A), clone 1A11