SNX8 purified MaxPab mouse polyclonal antibody (B01P)
  • SNX8 purified MaxPab mouse polyclonal antibody (B01P)

SNX8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029886-B01P
SNX8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNX8 protein.
Información adicional
Size 50 ug
Gene Name SNX8
Gene Alias Mvp1
Gene Description sorting nexin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX8 (NP_037453.1, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29886

Enviar un mensaje


SNX8 purified MaxPab mouse polyclonal antibody (B01P)

SNX8 purified MaxPab mouse polyclonal antibody (B01P)