ALG5 purified MaxPab mouse polyclonal antibody (B01P)
  • ALG5 purified MaxPab mouse polyclonal antibody (B01P)

ALG5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029880-B01P
ALG5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALG5 protein.
Información adicional
Size 50 ug
Gene Name ALG5
Gene Alias RP11-421P11.2|bA421P11.2
Gene Description asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALG5 (NP_037470.1, 1 a.a. ~ 324 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29880

Enviar un mensaje


ALG5 purified MaxPab mouse polyclonal antibody (B01P)

ALG5 purified MaxPab mouse polyclonal antibody (B01P)