ICOS purified MaxPab rabbit polyclonal antibody (D01P)
  • ICOS purified MaxPab rabbit polyclonal antibody (D01P)

ICOS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029851-D01P
ICOS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ICOS protein.
Información adicional
Size 100 ug
Gene Name ICOS
Gene Alias AILIM|CD278|MGC39850
Gene Description inducible T-cell co-stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ICOS (NP_036224.1, 1 a.a. ~ 199 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29851

Enviar un mensaje


ICOS purified MaxPab rabbit polyclonal antibody (D01P)

ICOS purified MaxPab rabbit polyclonal antibody (D01P)