REPIN1 polyclonal antibody (A01)
  • REPIN1 polyclonal antibody (A01)

REPIN1 polyclonal antibody (A01)

Ref: AB-H00029803-A01
REPIN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant REPIN1.
Información adicional
Size 50 uL
Gene Name REPIN1
Gene Alias AP4|RIP60|ZNF464|Zfp464
Gene Description replication initiator 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPECGRRFRHAPFLALHRQVHAAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen REPIN1 (NP_037532, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29803

Enviar un mensaje


REPIN1 polyclonal antibody (A01)

REPIN1 polyclonal antibody (A01)