Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZDHHC8 DNAxPab
Abnova
ZDHHC8 DNAxPab
Ref: AB-H00029801-W01P
ZDHHC8 DNAxPab
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a partial-length human ZDHHC8 DNA using DNAx™ Immune technology.
Información adicional
Size
100 ug
Gene Name
ZDHHC8
Gene Alias
ZDHHCL1|ZNF378
Gene Description
zinc finger, DHHC-type containing 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq
TRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFA
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ZDHHC8 (CAK54498.1, 149 a.a. ~ 702 a.a) partial-length human DNA
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
29801
Enviar un mensaje
ZDHHC8 DNAxPab
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*