Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZDHHC8 polyclonal antibody (A01)
Abnova
ZDHHC8 polyclonal antibody (A01)
Ref: AB-H00029801-A01
ZDHHC8 polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant ZDHHC8.
Información adicional
Size
50 uL
Gene Name
ZDHHC8
Gene Alias
ZDHHCL1|ZNF378
Gene Description
zinc finger, DHHC-type containing 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZDHHC8 (AAH09442, 1 a.a. ~ 42 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
29801
Enviar un mensaje
ZDHHC8 polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*