TMOD2 purified MaxPab mouse polyclonal antibody (B01P)
  • TMOD2 purified MaxPab mouse polyclonal antibody (B01P)

TMOD2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029767-B01P
TMOD2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMOD2 protein.
Información adicional
Size 50 ug
Gene Name TMOD2
Gene Alias MGC39481|N-TMOD|NTMOD
Gene Description tropomodulin 2 (neuronal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMOD2 (NP_055363.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29767

Enviar un mensaje


TMOD2 purified MaxPab mouse polyclonal antibody (B01P)

TMOD2 purified MaxPab mouse polyclonal antibody (B01P)