UHRF1 monoclonal antibody (M01J), clone 3A11
  • UHRF1 monoclonal antibody (M01J), clone 3A11

UHRF1 monoclonal antibody (M01J), clone 3A11

Ref: AB-H00029128-M01J
UHRF1 monoclonal antibody (M01J), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UHRF1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name UHRF1
Gene Alias FLJ21925|ICBP90|MGC138707|Np95|RNF106|hNP95
Gene Description ubiquitin-like with PHD and ring finger domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UHRF1 (NP_037414.1, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29128
Clone Number 3A11
Iso type IgG1 Kappa

Enviar un mensaje


UHRF1 monoclonal antibody (M01J), clone 3A11

UHRF1 monoclonal antibody (M01J), clone 3A11