LGALS13 purified MaxPab mouse polyclonal antibody (B01P)
  • LGALS13 purified MaxPab mouse polyclonal antibody (B01P)

LGALS13 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029124-B01P
LGALS13 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LGALS13 protein.
Información adicional
Size 50 ug
Gene Name LGALS13
Gene Alias GAL13|PLAC8|PP13
Gene Description lectin, galactoside-binding, soluble, 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LGALS13 (AAH66304.1, 1 a.a. ~ 139 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29124

Enviar un mensaje


LGALS13 purified MaxPab mouse polyclonal antibody (B01P)

LGALS13 purified MaxPab mouse polyclonal antibody (B01P)