BRD7 purified MaxPab mouse polyclonal antibody (B01P)
  • BRD7 purified MaxPab mouse polyclonal antibody (B01P)

BRD7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029117-B01P
BRD7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BRD7 protein.
Información adicional
Size 50 ug
Gene Name BRD7
Gene Alias BP75|CELTIX1|NAG4
Gene Description bromodomain containing 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSIIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BRD7 (AAH94706, 1 a.a. ~ 651 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29117

Enviar un mensaje


BRD7 purified MaxPab mouse polyclonal antibody (B01P)

BRD7 purified MaxPab mouse polyclonal antibody (B01P)