TAGLN3 monoclonal antibody (M01), clone 1D2
  • TAGLN3 monoclonal antibody (M01), clone 1D2

TAGLN3 monoclonal antibody (M01), clone 1D2

Ref: AB-H00029114-M01
TAGLN3 monoclonal antibody (M01), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TAGLN3.
Información adicional
Size 100 ug
Gene Name TAGLN3
Gene Alias NP22|NP25
Gene Description transgelin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAGLN3 (AAH15329, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29114
Clone Number 1D2
Iso type IgG1 kappa

Enviar un mensaje


TAGLN3 monoclonal antibody (M01), clone 1D2

TAGLN3 monoclonal antibody (M01), clone 1D2