TBK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TBK1 purified MaxPab rabbit polyclonal antibody (D01P)

TBK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029110-D01P
TBK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TBK1 protein.
Información adicional
Size 100 ug
Gene Name TBK1
Gene Alias FLJ11330|NAK|T2K
Gene Description TANK-binding kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBK1 (NP_037386.1, 1 a.a. ~ 729 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29110

Enviar un mensaje


TBK1 purified MaxPab rabbit polyclonal antibody (D01P)

TBK1 purified MaxPab rabbit polyclonal antibody (D01P)