FHOD1 purified MaxPab mouse polyclonal antibody (B01P)
  • FHOD1 purified MaxPab mouse polyclonal antibody (B01P)

FHOD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029109-B01P
FHOD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FHOD1 protein.
Información adicional
Size 50 ug
Gene Name FHOD1
Gene Alias FHOS
Gene Description formin homology 2 domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P
Immunogen Prot. Seq MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLFIRAVNSVASTTGAPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FHOD1 (NP_037373.2, 1 a.a. ~ 1164 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29109

Enviar un mensaje


FHOD1 purified MaxPab mouse polyclonal antibody (B01P)

FHOD1 purified MaxPab mouse polyclonal antibody (B01P)