Ver mas grande
PYCARD purified MaxPab mouse polyclonal antibody (B01P)
AB-H00029108-B01P
Producto nuevo
PYCARD purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | PYCARD |
| Gene Alias | ASC|CARD5|MGC10332|TMS|TMS-1|TMS1 |
| Gene Description | PYD and CARD domain containing |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PYCARD (AAH13569, 1 a.a. ~ 149 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 29108 |
Más información
Mouse polyclonal antibody raised against a full-length human PYCARD protein.